Lineage for d1t8ea2 (1t8e A:211-704)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016466Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3016741Protein T7 phage DNA polymerase [56678] (1 species)
  7. 3016742Species Bacteriophage T7 [TaxId:10760] [56679] (17 PDB entries)
    Uniprot P00581
  8. 3016751Domain d1t8ea2: 1t8e A:211-704 [112317]
    Other proteins in same PDB: d1t8ea1, d1t8eb_
    protein/DNA complex; complexed with dct, mes, mg, pg4, so4

Details for d1t8ea2

PDB Entry: 1t8e (more details), 2.54 Å

PDB Description: T7 DNA Polymerase Ternary Complex with dCTP at the Insertion Site.
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1t8ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8ea2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
leavdiehraawllakqerngfpfdtkaieelyvelaarrsellrkltetfgswyqpkgg
temfchprtgkplpkypriktpkvggifkkpknkaqregrepceldtreyvagapytpve
hvvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpekqaaidlikeyl
miqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeq
craafgaehhldgitgkpwvqagidasglelrclahfmarfdngeyaheilngdihtknq
iaaelptrdnaktfiygflygagdekigqivgagkergkelkkkflentpaiaalresiq
qtlvessqwvageqqvkwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikte
emlvekglkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrcll
dtegkmgpnwaich

SCOPe Domain Coordinates for d1t8ea2:

Click to download the PDB-style file with coordinates for d1t8ea2.
(The format of our PDB-style files is described here.)

Timeline for d1t8ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t8ea1
View in 3D
Domains from other chains:
(mouse over for more information)
d1t8eb_