![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species) fat depleting factor related to class I MHC |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54488] (8 PDB entries) Uniprot P25311 22-294 |
![]() | Domain d1t7za2: 1t7z A:5-183 [112311] Other proteins in same PDB: d1t7za1 complexed with nag |
PDB Entry: 1t7z (more details), 3 Å
SCOPe Domain Sequences for d1t7za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t7za2 d.19.1.1 (A:5-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens) [TaxId: 9606]} dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk qdsqlqkaredifmetlkdiveyykdstgshvlqgrfgceiennrssgafwkyyydgkdy iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr
Timeline for d1t7za2: