SCOPe 2.08: Domain d1t7za1: 1t7z A:184-277

Lineage for d1t7za1 (1t7z A:184-277)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species)
   fat depleting factor related to class I MHC

7. Species Human (Homo sapiens) [TaxId:9606] [48966] (8 PDB entries)
   Uniprot P25311 22-294

8. Domain d1t7za1: 1t7z A:184-277 [112310]
   Other proteins in same PDB: d1t7za2
   complexed with nag

Details for d1t7za1

PDB Entry: 1t7z, 3 Å

PDB Description: zn-alpha-2-glycoprotein; baculo-zag no peg, no glycerol

PDB Compounds: (A:) Zinc-alpha-2-glycoprotein

SCOPe Domain Sequences for d1t7za1:

Sequence; same for both SEQRES and ATOM records:

>d1t7za1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpwea

Timeline for d1t7za1:

• d1t7za1 first appeared in SCOP 1.71
  
• d1t7za1 appears in SCOPe 2.07