Lineage for d1t7ya2 (1t7y A:5-183)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 857019Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species)
    fat depleting factor related to class I MHC
  7. 857020Species Human (Homo sapiens) [TaxId:9606] [54488] (7 PDB entries)
    Uniprot P25311 22-294
  8. 857024Domain d1t7ya2: 1t7y A:5-183 [112309]
    Other proteins in same PDB: d1t7ya1
    complexed with nag; mutant

Details for d1t7ya2

PDB Entry: 1t7y (more details), 2.8 Å

PDB Description: zn-alpha-2-glycoprotein; baculo-zag peg 200, no glycerol
PDB Compounds: (A:) Zinc-alpha-2-glycoprotein

SCOP Domain Sequences for d1t7ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7ya2 d.19.1.1 (A:5-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens) [TaxId: 9606]}
dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
qdsqlqkaredifmetlkdiveyykdstgshvlqgrfgceiennrssgafwkyyydgkdy
iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr

SCOP Domain Coordinates for d1t7ya2:

Click to download the PDB-style file with coordinates for d1t7ya2.
(The format of our PDB-style files is described here.)

Timeline for d1t7ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t7ya1