| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species) fat depleting factor related to class I MHC |
| Species Human (Homo sapiens) [TaxId:9606] [54488] (7 PDB entries) Uniprot P25311 22-294 |
| Domain d1t7xa2: 1t7x A:5-183 [112307] Other proteins in same PDB: d1t7xa1 complexed with nag |
PDB Entry: 1t7x (more details), 3.1 Å
SCOPe Domain Sequences for d1t7xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t7xa2 d.19.1.1 (A:5-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens) [TaxId: 9606]}
dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
qdsqlqkaredifmetlkdiveyykdstgshvlqgrfgceiennrssgafwkyyydgkdy
iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr
Timeline for d1t7xa2: