Lineage for d1t7xa1 (1t7x A:184-277)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029170Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species)
    fat depleting factor related to class I MHC
  7. 2029171Species Human (Homo sapiens) [TaxId:9606] [48966] (7 PDB entries)
    Uniprot P25311 22-294
  8. 2029181Domain d1t7xa1: 1t7x A:184-277 [112306]
    Other proteins in same PDB: d1t7xa2
    complexed with nag

Details for d1t7xa1

PDB Entry: 1t7x (more details), 3.1 Å

PDB Description: zn-alpha-2-glycoprotein; refolded cho-zag peg 400
PDB Compounds: (A:) Zinc-alpha-2-glycoprotein

SCOPe Domain Sequences for d1t7xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7xa1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpwea

SCOPe Domain Coordinates for d1t7xa1:

Click to download the PDB-style file with coordinates for d1t7xa1.
(The format of our PDB-style files is described here.)

Timeline for d1t7xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t7xa2