Lineage for d1t7wa2 (1t7w A:5-183)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545601Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species)
    fat depleting factor related to class I MHC
  7. 2545602Species Human (Homo sapiens) [TaxId:9606] [54488] (8 PDB entries)
    Uniprot P25311 22-294
  8. 2545615Domain d1t7wa2: 1t7w A:5-183 [112305]
    Other proteins in same PDB: d1t7wa1
    complexed with nag

Details for d1t7wa2

PDB Entry: 1t7w (more details), 2.7 Å

PDB Description: zn-alpha-2-glycoprotein; cho-zag peg 400
PDB Compounds: (A:) Zinc-alpha-2-glycoprotein

SCOPe Domain Sequences for d1t7wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7wa2 d.19.1.1 (A:5-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens) [TaxId: 9606]}
dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
qdsqlqkaredifmetlkdiveyykdstgshvlqgrfgceiennrssgafwkyyydgkdy
iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr

SCOPe Domain Coordinates for d1t7wa2:

Click to download the PDB-style file with coordinates for d1t7wa2.
(The format of our PDB-style files is described here.)

Timeline for d1t7wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t7wa1