| Class b: All beta proteins [48724] (149 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species) fat depleting factor related to class I MHC |
| Species Human (Homo sapiens) [TaxId:9606] [48966] (7 PDB entries) |
| Domain d1t7wa1: 1t7w A:184-277 [112304] Other proteins in same PDB: d1t7wa2 complexed with nag; mutant |
PDB Entry: 1t7w (more details), 2.7 Å
SCOP Domain Sequences for d1t7wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t7wa1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens)}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpwea
Timeline for d1t7wa1: