![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (2 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Human immunodeficiency virus type 1 protease [50632] (1 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (179 PDB entries) |
![]() | Domain d1t7ka_: 1t7k A: [112300] |
PDB Entry: 1t7k (more details), 2.1 Å
SCOP Domain Sequences for d1t7ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t7ka_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1} pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd qilieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d1t7ka_: