SCOP 1.73: Domain d1t77d2: 1t77 D:2076-2185

Lineage for d1t77d2 (1t77 D:2076-2185)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (12 families)

5. Family b.55.1.6: PreBEACH PH-like domain [82146] (2 proteins)

6. Protein Lipopolysaccharide-responsive and beige-like anchor protein LRBA [117263] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117264] (1 PDB entry)

8. Domain d1t77d2: 1t77 D:2076-2185 [112297]
   Other proteins in same PDB: d1t77a1, d1t77b1, d1t77c1, d1t77d1

Details for d1t77d2

PDB Entry: 1t77, 2.4 Å

PDB Description: Crystal structure of the PH-BEACH domains of human LRBA/BGL

PDB Compounds: (D:) Lipopolysaccharide-responsive and beige-like anchor protein

SCOP Domain Sequences for d1t77d2:

Sequence; same for both SEQRES and ATOM records:

>d1t77d2 b.55.1.6 (D:2076-2185) Lipopolysaccharide-responsive and beige-like anchor protein LRBA {Human (Homo sapiens) [TaxId: 9606]}
gpvslstpaqlvapsvvvkgtlsvtsselyfevdeedpnfkkidpkilayteglhgkwlf
teirsifsrryllqntaleifmanrvavmfnfpdpatvkkvvnflprvgv

Timeline for d1t77d2:

• d1t77d2 first appeared in SCOP 1.71
  
• d1t77d2 appears in SCOP 1.75
  
• d1t77d2 appears in the current release, SCOPe 2.08