SCOP 1.71: Domain d1t77d2: 1t77 D:2076-2185

Lineage for d1t77d2 (1t77 D:2076-2185)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.55: PH domain-like [50728] (1 superfamily)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
Superfamily b.55.1: PH domain-like [50729] (9 families)
Family b.55.1.6: PreBEACH PH-like domain [82146] (2 proteins)
Protein Lipopolysaccharide-responsive and beige-like anchor protein LRBA [117263] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [117264] (1 PDB entry)
Domain d1t77d2: 1t77 D:2076-2185 [112297]
Other proteins in same PDB: d1t77a1, d1t77b1, d1t77c1, d1t77d1

Details for d1t77d2

PDB Entry: 1t77 (more details), 2.4 Å

PDB Description: Crystal structure of the PH-BEACH domains of human LRBA/BGL

SCOP Domain Sequences for d1t77d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t77d2 b.55.1.6 (D:2076-2185) Lipopolysaccharide-responsive and beige-like anchor protein LRBA {Human (Homo sapiens)}
gpvslstpaqlvapsvvvkgtlsvtsselyfevdeedpnfkkidpkilayteglhgkwlf
teirsifsrryllqntaleifmanrvavmfnfpdpatvkkvvnflprvgv

SCOP Domain Coordinates for d1t77d2:

Click to download the PDB-style file with coordinates for d1t77d2.
(The format of our PDB-style files is described here.)

Timeline for d1t77d2: