Lineage for d1t77c2 (1t77 C:2076-2185)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673392Family b.55.1.6: PreBEACH PH-like domain [82146] (2 proteins)
  6. 673393Protein Lipopolysaccharide-responsive and beige-like anchor protein LRBA [117263] (1 species)
  7. 673394Species Human (Homo sapiens) [TaxId:9606] [117264] (1 PDB entry)
  8. 673397Domain d1t77c2: 1t77 C:2076-2185 [112295]
    Other proteins in same PDB: d1t77a1, d1t77b1, d1t77c1, d1t77d1

Details for d1t77c2

PDB Entry: 1t77 (more details), 2.4 Å

PDB Description: Crystal structure of the PH-BEACH domains of human LRBA/BGL
PDB Compounds: (C:) Lipopolysaccharide-responsive and beige-like anchor protein

SCOP Domain Sequences for d1t77c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t77c2 b.55.1.6 (C:2076-2185) Lipopolysaccharide-responsive and beige-like anchor protein LRBA {Human (Homo sapiens) [TaxId: 9606]}
gpvslstpaqlvapsvvvkgtlsvtsselyfevdeedpnfkkidpkilayteglhgkwlf
teirsifsrryllqntaleifmanrvavmfnfpdpatvkkvvnflprvgv

SCOP Domain Coordinates for d1t77c2:

Click to download the PDB-style file with coordinates for d1t77c2.
(The format of our PDB-style files is described here.)

Timeline for d1t77c2: