SCOPe 2.07: Domain d1t77b2: 1t77 B:2076-2185

Lineage for d1t77b2 (1t77 B:2076-2185)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.6: PreBEACH PH-like domain [82146] (2 proteins)

6. Protein Lipopolysaccharide-responsive and beige-like anchor protein LRBA [117263] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117264] (1 PDB entry)
   Uniprot P50851 2076-2489

8. Domain d1t77b2: 1t77 B:2076-2185 [112293]
   Other proteins in same PDB: d1t77a1, d1t77b1, d1t77c1, d1t77d1

Details for d1t77b2

PDB Entry: 1t77, 2.4 Å

PDB Description: Crystal structure of the PH-BEACH domains of human LRBA/BGL

PDB Compounds: (B:) Lipopolysaccharide-responsive and beige-like anchor protein

SCOPe Domain Sequences for d1t77b2:

Sequence; same for both SEQRES and ATOM records:

>d1t77b2 b.55.1.6 (B:2076-2185) Lipopolysaccharide-responsive and beige-like anchor protein LRBA {Human (Homo sapiens) [TaxId: 9606]}
gpvslstpaqlvapsvvvkgtlsvtsselyfevdeedpnfkkidpkilayteglhgkwlf
teirsifsrryllqntaleifmanrvavmfnfpdpatvkkvvnflprvgv

Timeline for d1t77b2:

• d1t77b2 first appeared in SCOP 1.71
  
• d1t77b2 appears in SCOPe 2.06
  
• d1t77b2 appears in the current release, SCOPe 2.08