SCOP 1.73: Domain d1t77a1: 1t77 A:2186-2489

Lineage for d1t77a1 (1t77 A:2186-2489)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.169: BEACH domain [81836] (1 superfamily)
   multihelical, complex architecture

4. Superfamily a.169.1: BEACH domain [81837] (1 family)

5. Family a.169.1.1: BEACH domain [81838] (2 proteins)
   Pfam PF02138

6. Protein Lipopolysaccharide-responsive and beige-like anchor protein LRBA [116981] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116982] (1 PDB entry)

8. Domain d1t77a1: 1t77 A:2186-2489 [112290]
   Other proteins in same PDB: d1t77a2, d1t77b2, d1t77c2, d1t77d2

Details for d1t77a1

PDB Entry: 1t77, 2.4 Å

PDB Description: Crystal structure of the PH-BEACH domains of human LRBA/BGL

PDB Compounds: (A:) Lipopolysaccharide-responsive and beige-like anchor protein

SCOP Domain Sequences for d1t77a1:

Sequence; same for both SEQRES and ATOM records:

>d1t77a1 a.169.1.1 (A:2186-2489) Lipopolysaccharide-responsive and beige-like anchor protein LRBA {Human (Homo sapiens) [TaxId: 9606]}
gtsfglpqtrrislasprqlfkasnmtqrwqhreisnfeylmflntiagrsyndlnqypv
fpwvitnyeseeldltlptnfrdlskpigalnpkraaffaeryesweddqvpkfhygthy
stasfvlawllriepfttyflnlqggkfdhadrtfssisrawrnsqrdtsdikelipefy
ylpemfvnfnnynlgvmddgtvvsdvelppwaktseefvhinrlalesefvscqlhqwid
lifgykqqgpeavralnvfyyltyegavnlnsitdpvlreaveaqirsfgqtpsqlliep
hppr

Timeline for d1t77a1:

• d1t77a1 first appeared in SCOP 1.71
  
• d1t77a1 appears in SCOP 1.75
  
• d1t77a1 appears in the current release, SCOPe 2.08