Lineage for d1t72g1 (1t72 G:7-213)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696852Superfamily a.7.12: PhoU-like [109755] (2 families) (S)
    duplication: consists of two sequence each repeats adopting this fold
  5. 2696853Family a.7.12.1: PhoU-like [109756] (3 proteins)
    Pfam PF01895
    this is a repeat family; one repeat unit is 1vct A:9-107 found in domain
  6. 2696860Protein Phosphate transport system protein PhoU [116839] (2 species)
  7. 2696861Species Aquifex aeolicus [TaxId:63363] [116840] (2 PDB entries)
    Uniprot O67053 1-209
  8. 2696867Domain d1t72g1: 1t72 G:7-213 [112289]
    Other proteins in same PDB: d1t72a2, d1t72b2, d1t72d2, d1t72e2, d1t72f2, d1t72g2
    Structural genomics target

Details for d1t72g1

PDB Entry: 1t72 (more details), 2.9 Å

PDB Description: Crystal structure of phosphate transport system protein phoU from Aquifex aeolicus
PDB Compounds: (G:) Phosphate transport system protein phoU homolog

SCOPe Domain Sequences for d1t72g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t72g1 a.7.12.1 (G:7-213) Phosphate transport system protein PhoU {Aquifex aeolicus [TaxId: 63363]}
mklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidllevdierr
cirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpyvninfm
seivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprnikramh
lsfvarhyeriadhaenvaeaaiylse

SCOPe Domain Coordinates for d1t72g1:

Click to download the PDB-style file with coordinates for d1t72g1.
(The format of our PDB-style files is described here.)

Timeline for d1t72g1: