SCOP 1.73: Domain d1t72f_: 1t72 F:

Lineage for d1t72f_ (1t72 F:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.12: PhoU-like [109755] (1 family)
   duplication: consists of two sequence each repeats adopting this fold

5. Family a.7.12.1: PhoU-like [109756] (3 proteins)
   Pfam PF01895
   this is a repeat family; one repeat unit is 1vct A:9-107 found in domain

6. Protein Phosphate transport system protein PhoU [116839] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [116840] (2 PDB entries)

8. Domain d1t72f_: 1t72 F: [112288]

Details for d1t72f_

PDB Entry: 1t72, 2.9 Å

PDB Description: Crystal structure of phosphate transport system protein phoU from Aquifex aeolicus

PDB Compounds: (F:) Phosphate transport system protein phoU homolog

SCOP Domain Sequences for d1t72f_:

Sequence; same for both SEQRES and ATOM records:

>d1t72f_ a.7.12.1 (F:) Phosphate transport system protein PhoU {Aquifex aeolicus [TaxId: 63363]}
gggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidllev
dierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpyv
ninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprni
kramhlsfvarhyeriadhaenvaeaaiylsege

Timeline for d1t72f_:

• d1t72f_ first appeared in SCOP 1.71
  
• d1t72f_ appears in SCOP 1.75
  
• d1t72f_ appears in the current release, SCOPe 2.08, called d1t72f1