Lineage for d1t72f_ (1t72 F:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534473Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 534650Superfamily a.7.12: PhoU-like [109755] (1 family) (S)
    duplication: consists of two sequence each repeats adopting this fold
  5. 534651Family a.7.12.1: PhoU-like [109756] (2 proteins)
    Pfam 01895
    this is a repeat family; one repeat unit is 1vct A:9-107 found in domain
  6. 534652Protein Phosphate transport system protein PhoU [116839] (2 species)
  7. 534653Species Aquifex aeolicus [TaxId:63363] [116840] (2 PDB entries)
  8. 534658Domain d1t72f_: 1t72 F: [112288]

Details for d1t72f_

PDB Entry: 1t72 (more details), 2.9 Å

PDB Description: Crystal structure of phosphate transport system protein phoU from Aquifex aeolicus

SCOP Domain Sequences for d1t72f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t72f_ a.7.12.1 (F:) Phosphate transport system protein PhoU {Aquifex aeolicus}
gggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidllev
dierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpyv
ninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprni
kramhlsfvarhyeriadhaenvaeaaiylsege

SCOP Domain Coordinates for d1t72f_:

Click to download the PDB-style file with coordinates for d1t72f_.
(The format of our PDB-style files is described here.)

Timeline for d1t72f_: