SCOP 1.71: Domain d1t72e_: 1t72 E:

Lineage for d1t72e_ (1t72 E:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.12: PhoU-like [109755] (1 family)
   duplication: consists of two sequence each repeats adopting this fold

5. Family a.7.12.1: PhoU-like [109756] (2 proteins)
   Pfam 01895
   this is a repeat family; one repeat unit is 1vct A:9-107 found in domain

6. Protein Phosphate transport system protein PhoU [116839] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [116840] (2 PDB entries)

8. Domain d1t72e_: 1t72 E: [112287]

Details for d1t72e_

PDB Entry: 1t72, 2.9 Å

PDB Description: Crystal structure of phosphate transport system protein phoU from Aquifex aeolicus

SCOP Domain Sequences for d1t72e_:

Sequence; same for both SEQRES and ATOM records:

>d1t72e_ a.7.12.1 (E:) Phosphate transport system protein PhoU {Aquifex aeolicus}
ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
ikramhlsfvarhyeriadhaenvaeaaiylse

Timeline for d1t72e_:

• d1t72e_ is new in SCOP 1.71
  
• d1t72e_ appears in SCOP 1.73
  
• d1t72e_ appears in the current release, SCOPe 2.08, called d1t72e1