Lineage for d1t72d_ (1t72 D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763928Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764180Superfamily a.7.12: PhoU-like [109755] (1 family) (S)
    duplication: consists of two sequence each repeats adopting this fold
  5. 764181Family a.7.12.1: PhoU-like [109756] (3 proteins)
    Pfam PF01895
    this is a repeat family; one repeat unit is 1vct A:9-107 found in domain
  6. 764188Protein Phosphate transport system protein PhoU [116839] (2 species)
  7. 764189Species Aquifex aeolicus [TaxId:63363] [116840] (2 PDB entries)
    Uniprot O67053 1-209
  8. 764192Domain d1t72d_: 1t72 D: [112286]
    Structural genomics target

Details for d1t72d_

PDB Entry: 1t72 (more details), 2.9 Å

PDB Description: Crystal structure of phosphate transport system protein phoU from Aquifex aeolicus
PDB Compounds: (D:) Phosphate transport system protein phoU homolog

SCOP Domain Sequences for d1t72d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t72d_ a.7.12.1 (D:) Phosphate transport system protein PhoU {Aquifex aeolicus [TaxId: 63363]}
ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
ikramhlsfvarhyeriadhaenvaeaaiylsege

SCOP Domain Coordinates for d1t72d_:

Click to download the PDB-style file with coordinates for d1t72d_.
(The format of our PDB-style files is described here.)

Timeline for d1t72d_: