SCOPe 2.08: Domain d1t72a1: 1t72 A:7-215

Lineage for d1t72a1 (1t72 A:7-215)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.12: PhoU-like [109755] (2 families)
   duplication: consists of two sequence each repeats adopting this fold

5. Family a.7.12.1: PhoU-like [109756] (3 proteins)
   Pfam PF01895
   this is a repeat family; one repeat unit is 1vct A:9-107 found in domain

6. Protein Phosphate transport system protein PhoU [116839] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [116840] (2 PDB entries)
   Uniprot O67053 1-209

8. Domain d1t72a1: 1t72 A:7-215 [112284]
   Other proteins in same PDB: d1t72a2, d1t72b2, d1t72d2, d1t72e2, d1t72f2, d1t72g2
   Structural genomics target

Details for d1t72a1

PDB Entry: 1t72, 2.9 Å

PDB Description: Crystal structure of phosphate transport system protein phoU from Aquifex aeolicus

PDB Compounds: (A:) Phosphate transport system protein phoU homolog

SCOPe Domain Sequences for d1t72a1:

Sequence; same for both SEQRES and ATOM records:

>d1t72a1 a.7.12.1 (A:7-215) Phosphate transport system protein PhoU {Aquifex aeolicus [TaxId: 63363]}
mklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidllevdierr
cirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpyvninfm
seivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprnikramh
lsfvarhyeriadhaenvaeaaiylsege

Timeline for d1t72a1:

• d1t72a1 first appeared in SCOP 1.71, called d1t72a_
  
• d1t72a1 appears in SCOPe 2.07