![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.9: DR1281-like [118155] (2 proteins) automatically mapped to Pfam PF13277 |
![]() | Protein Hypothetical protein MPN349 [118158] (1 species) |
![]() | Species Mycoplasma pneumoniae [TaxId:2104] [118159] (1 PDB entry) Uniprot P75429 |
![]() | Domain d1t71a_: 1t71 A: [112283] Structural genomics target complexed with fe |
PDB Entry: 1t71 (more details), 2.1 Å
SCOPe Domain Sequences for d1t71a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} mmnsikfiflgdvygkagrniiknnlaqlkskyqadlvivnaentthgkglslkhyeflk eagvnyitmgnhtwfqkldlavvinkkdlvrplnldtsfafhnlgqgslvfefnkakiri tnllgtsvplpfkttnpfkvlkelilkrdcdlhivdfhaettseknafcmafdgyvttif gththvpsadlritpkgsayitdvgmcgpgfgsviganpeqsirlfcagsrehfevskcg aqlngvffevdvntkkvikteairiveddprylkqdyfnli
Timeline for d1t71a_: