Lineage for d1t70h_ (1t70 H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998410Family d.159.1.9: DR1281-like [118155] (2 proteins)
    automatically mapped to Pfam PF13277
  6. 2998414Protein Putative phosphatase DR1281 [118156] (1 species)
  7. 2998415Species Deinococcus radiodurans [TaxId:1299] [118157] (1 PDB entry)
    Uniprot Q9RUV0
  8. 2998423Domain d1t70h_: 1t70 H: [112282]
    Structural genomics target

Details for d1t70h_

PDB Entry: 1t70 (more details), 2.3 Å

PDB Description: crystal structure of a novel phosphatase from deinococcus radiodurans
PDB Compounds: (H:) phosphatase

SCOPe Domain Sequences for d1t70h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t70h_ d.159.1.9 (H:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]}
mrvlfigdvfgqpgrrvlqnhlptirpqfdfvivnmensaggfgmhrdaargaleagagc
ltlgnhawhhkdiypmlsedtypivrplnyadpgtpgvgwrtfdvngekltvvnllgrvf
meavdnpfrtmdallerddlgtvfvdfhaeatsekeamgwhlagrvaavigththvptad
trilkggtayqtdagftgphdsiigsaiegplqrflterphrygvaegraelngvalhfe
ggkataaeryrfied

SCOPe Domain Coordinates for d1t70h_:

Click to download the PDB-style file with coordinates for d1t70h_.
(The format of our PDB-style files is described here.)

Timeline for d1t70h_: