Lineage for d1t70g_ (1t70 G:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 613398Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 613399Superfamily d.159.1: Metallo-dependent phosphatases [56300] (9 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam 00149
  5. 613514Family d.159.1.9: DR1281-like [118155] (2 proteins)
  6. 613518Protein Putative phosphatase DR1281 [118156] (1 species)
  7. 613519Species Deinococcus radiodurans [TaxId:1299] [118157] (1 PDB entry)
  8. 613526Domain d1t70g_: 1t70 G: [112281]

Details for d1t70g_

PDB Entry: 1t70 (more details), 2.3 Å

PDB Description: crystal structure of a novel phosphatase from deinococcus radiodurans

SCOP Domain Sequences for d1t70g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t70g_ d.159.1.9 (G:) Putative phosphatase DR1281 {Deinococcus radiodurans}
mrvlfigdvfgqpgrrvlqnhlptirpqfdfvivnmensaggfgmhrdaargaleagagc
ltlgnhawhhkdiypmlsedtypivrplnyadpgtpgvgwrtfdvngekltvvnllgrvf
meavdnpfrtmdallerddlgtvfvdfhaeatsekeamgwhlagrvaavigththvptad
trilkggtayqtdagftgphdsiigsaiegplqrflterphrygvaegraelngvalhfe
ggkataaeryrfied

SCOP Domain Coordinates for d1t70g_:

Click to download the PDB-style file with coordinates for d1t70g_.
(The format of our PDB-style files is described here.)

Timeline for d1t70g_: