SCOPe 2.08: Domain d1t6sa2: 1t6s A:86-162

Lineage for d1t6sa2 (1t6s A:86-162)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.60: ScpB/YpuH-like [116804] (1 protein)
   Pfam PF04079
   duplication: tandem repeat of two 'winged helix' domains; forms a dimer via the C-terminal domain

6. Protein Segregation and condensation protein B, ScpB [116805] (1 species)

7. Species Chlorobium tepidum [TaxId:1097] [116806] (1 PDB entry)
   Uniprot Q8KF54 1-162

8. Domain d1t6sa2: 1t6s A:86-162 [112272]
   Structural genomics target
   complexed with no3

Details for d1t6sa2

PDB Entry: 1t6s, 1.95 Å

PDB Description: Crystal structure of a conserved hypothetical protein from Chlorobium tepidum

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1t6sa2:

Sequence; same for both SEQRES and ATOM records:

>d1t6sa2 a.4.5.60 (A:86-162) Segregation and condensation protein B, ScpB {Chlorobium tepidum [TaxId: 1097]}
pviqrrlsrsmlevlavvawhqpvtkgeiqqirgaspdysidrllarglievrgradspg
rplqygttevfldlfhl

Timeline for d1t6sa2:

• d1t6sa2 first appeared in SCOP 1.71
  
• d1t6sa2 appears in SCOPe 2.07