Lineage for d1t6pe_ (1t6p E:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543916Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 543917Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 544018Family a.127.1.2: HAL/PAL-like [48572] (2 proteins)
    Pfam 00221
  6. 544030Protein Phenylalanine ammonia-lyase, PAL [117028] (2 species)
  7. 544031Species Fungi (Rhodosporidium toruloides) [TaxId:5286] [117029] (2 PDB entries)
  8. 544038Domain d1t6pe_: 1t6p E: [112267]

Details for d1t6pe_

PDB Entry: 1t6p (more details), 2.7 Å

PDB Description: crystal structure of phenylalanine ammonia lyase from rhodosporidium toruloides

SCOP Domain Sequences for d1t6pe_:

Sequence, based on SEQRES records: (download)

>d1t6pe_ a.127.1.2 (E:) Phenylalanine ammonia-lyase, PAL {Fungi (Rhodosporidium toruloides)}
stnlavagshlpttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkd
sdeirskidksveflrsqlsmsvygvttgfggsadtrtedaislqkallehqlcgvlpss
fdsfrlgrglenslplevvrgamtirvnsltrghsavrlvvlealtnflnhgitpivplr
gtisasgdlsplsyiaaaisghpdskvhvvhegkekilyareamalfnlepvvlgpkegl
glvngtavsasmatlalhdahmlsllsqsltamtveamvghagsfhpflhdvtrphptqi
evagnirkllegsrfavhheeevkvkddegilrqdryplrtspqwlgplvsdlihahavl
tieagqsttdnplidvenktshhggnfqaaavantmektrlglaqigklnftqltemlna
gmnrglpsclaaedpslsyhckgldiaaaaytselghlanpvtthvqpaemanqavnsla
lisarrttesndvlslllathlycvlqaidlraiefefkkqfgpaivslidqhfgsamtg
snlrdelvekvnktlakrleqtnsydlvprwhdafsfaagtvvevlsstslslaavnawk
vaaaesaisltrqvretfwsaastsspalsylsprtqilyafvreelgvkarrgdvflgk
qevtigsnvskiyeaiksgrinnvllkmla

Sequence, based on observed residues (ATOM records): (download)

>d1t6pe_ a.127.1.2 (E:) Phenylalanine ammonia-lyase, PAL {Fungi (Rhodosporidium toruloides)}
stnlavagshlpttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkd
sdeirskidksveflrsqtedaislqkallehqlcgvlpssfdsfrlgrglenslplevv
rgamtirvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaai
sghpdskvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhd
ahmlsllsqsltamtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhh
qdryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaava
ntmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaayts
elghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlra
iefefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhd
afsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsyls
prtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla

SCOP Domain Coordinates for d1t6pe_:

Click to download the PDB-style file with coordinates for d1t6pe_.
(The format of our PDB-style files is described here.)

Timeline for d1t6pe_: