Lineage for d1t6pe_ (1t6p E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010395Family a.127.1.2: HAL/PAL-like [48572] (2 protein domains)
    Pfam PF00221
  6. 2010407Protein Phenylalanine ammonia-lyase, PAL [117028] (2 species)
  7. 2010408Species Fungus (Rhodosporidium toruloides) [TaxId:5286] [117029] (3 PDB entries)
    Uniprot P11544
  8. 2010419Domain d1t6pe_: 1t6p E: [112267]

Details for d1t6pe_

PDB Entry: 1t6p (more details), 2.7 Å

PDB Description: Crystal Structure of Phenylalanine Ammonia Lyase from Rhodosporidium toruloides
PDB Compounds: (E:) phenylalanine ammonia-lyase

SCOPe Domain Sequences for d1t6pe_:

Sequence, based on SEQRES records: (download)

>d1t6pe_ a.127.1.2 (E:) Phenylalanine ammonia-lyase, PAL {Fungus (Rhodosporidium toruloides) [TaxId: 5286]}
stnlavagshlpttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkd
sdeirskidksveflrsqlsmsvygvttgfggsadtrtedaislqkallehqlcgvlpss
fdsfrlgrglenslplevvrgamtirvnsltrghsavrlvvlealtnflnhgitpivplr
gtisasgdlsplsyiaaaisghpdskvhvvhegkekilyareamalfnlepvvlgpkegl
glvngtavsasmatlalhdahmlsllsqsltamtveamvghagsfhpflhdvtrphptqi
evagnirkllegsrfavhheeevkvkddegilrqdryplrtspqwlgplvsdlihahavl
tieagqsttdnplidvenktshhggnfqaaavantmektrlglaqigklnftqltemlna
gmnrglpsclaaedpslsyhckgldiaaaaytselghlanpvtthvqpaemanqavnsla
lisarrttesndvlslllathlycvlqaidlraiefefkkqfgpaivslidqhfgsamtg
snlrdelvekvnktlakrleqtnsydlvprwhdafsfaagtvvevlsstslslaavnawk
vaaaesaisltrqvretfwsaastsspalsylsprtqilyafvreelgvkarrgdvflgk
qevtigsnvskiyeaiksgrinnvllkmla

Sequence, based on observed residues (ATOM records): (download)

>d1t6pe_ a.127.1.2 (E:) Phenylalanine ammonia-lyase, PAL {Fungus (Rhodosporidium toruloides) [TaxId: 5286]}
stnlavagshlpttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkd
sdeirskidksveflrsqtedaislqkallehqlcgvlpssfdsfrlgrglenslplevv
rgamtirvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaai
sghpdskvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhd
ahmlsllsqsltamtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhh
qdryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaava
ntmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaayts
elghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlra
iefefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhd
afsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsyls
prtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla

SCOPe Domain Coordinates for d1t6pe_:

Click to download the PDB-style file with coordinates for d1t6pe_.
(The format of our PDB-style files is described here.)

Timeline for d1t6pe_: