SCOP 1.71: Domain d1t6ka2: 1t6k A:129-278

Lineage for d1t6ka2 (1t6k A:129-278)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
   Pfam 02567

6. Protein Phenazine biosynthesis protein PhzF [117861] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [117862] (6 PDB entries)

8. Domain d1t6ka2: 1t6k A:129-278 [112262]
   complexed with so4

Details for d1t6ka2

PDB Entry: 1t6k, 1.8 Å

PDB Description: Crystal structure of phzF from Pseudomonas fluorescens 2-79

SCOP Domain Sequences for d1t6ka2:

Sequence; same for both SEQRES and ATOM records:

>d1t6ka2 d.21.1.2 (A:129-278) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens}
rdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnfhdmaincfa
gagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqgveigrpslm
fakaegraeqltrvevsgngvtfgrgtivl

Timeline for d1t6ka2:

• d1t6ka2 is new in SCOP 1.71
  
• d1t6ka2 appears in SCOP 1.73
  
• d1t6ka2 appears in the current release, SCOPe 2.08