SCOPe 2.08: Domain d1t6ka1: 1t6k A:1-128

Lineage for d1t6ka1 (1t6k A:1-128)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
   Pfam PF02567

6. Protein Phenazine biosynthesis protein PhzF [117861] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [117862] (7 PDB entries)
   Uniprot Q51792

8. Domain d1t6ka1: 1t6k A:1-128 [112261]
   complexed with so4

Details for d1t6ka1

PDB Entry: 1t6k, 1.8 Å

PDB Description: Crystal structure of phzF from Pseudomonas fluorescens 2-79

PDB Compounds: (A:) Phenazine biosynthesis protein phzF

SCOPe Domain Sequences for d1t6ka1:

Sequence; same for both SEQRES and ATOM records:

>d1t6ka1 d.21.1.2 (A:1-128) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]}
mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdali
riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp
iptwtalg

Timeline for d1t6ka1:

• d1t6ka1 first appeared in SCOP 1.71
  
• d1t6ka1 appears in SCOPe 2.07