Lineage for d1t6jb_ (1t6j B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337357Family a.127.1.2: HAL/PAL-like [48572] (3 protein domains)
    Pfam PF00221
  6. 2337369Protein Phenylalanine ammonia-lyase, PAL [117028] (2 species)
  7. 2337370Species Fungus (Rhodosporidium toruloides) [TaxId:5286] [117029] (3 PDB entries)
    Uniprot P11544
  8. 2337376Domain d1t6jb_: 1t6j B: [112260]
    complexed with cin

Details for d1t6jb_

PDB Entry: 1t6j (more details), 2.1 Å

PDB Description: crystal structure of phenylalanine ammonia lyase from rhodosporidium toruloides
PDB Compounds: (B:) phenylalanine ammonia-lyase

SCOPe Domain Sequences for d1t6jb_:

Sequence, based on SEQRES records: (download)

>d1t6jb_ a.127.1.2 (B:) Phenylalanine ammonia-lyase, PAL {Fungus (Rhodosporidium toruloides) [TaxId: 5286]}
ttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkdsdeirskidksv
eflrsqlsmsvygvttgfggsadtrtedaislqkallehqlcgvlpssfdsfrlgrglen
slplevvrgamtirvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlspl
syiaaaisghpdskvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasm
atlalhdahmlsllsqsltamtveamvghagsfhpflhdvtrphptqievagnirklleg
srfavhheeevkvkddegilrqdryplrtspqwlgplvsdlihahavltieagqsttdnp
lidvenktshhggnfqaaavantmektrlglaqigklnftqltemlnagmnrglpsclaa
edpslsyhckgldiaaaaytselghlanpvtthvqpaemanqavnslalisarrttesnd
vlslllathlycvlqaidlraiefefkkqfgpaivslidqhfgsamtgsnlrdelvekvn
ktlakrleqtnsydlvprwhdafsfaagtvvevlsstslslaavnawkvaaaesaisltr
qvretfwsaastsspalsylsprtqilyafvreelgvkarrgdvflgkqevtigsnvski
yeaiksgrinnvllkmla

Sequence, based on observed residues (ATOM records): (download)

>d1t6jb_ a.127.1.2 (B:) Phenylalanine ammonia-lyase, PAL {Fungus (Rhodosporidium toruloides) [TaxId: 5286]}
ttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkdsdeirskidksv
eflrsqtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnslt
rghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvh
egkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqslt
amtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeerqdryplrt
spqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavantmektrl
glaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytselghlanp
vtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlraiefefkkq
fgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhdafsfaagt
vvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsprtqilya
fvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla

SCOPe Domain Coordinates for d1t6jb_:

Click to download the PDB-style file with coordinates for d1t6jb_.
(The format of our PDB-style files is described here.)

Timeline for d1t6jb_: