SCOP 1.71: Domain d1t6ha_: 1t6h A:

Lineage for d1t6ha_ (1t6h A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (405 PDB entries)
   many mutant structures

8. Domain d1t6ha_: 1t6h A: [112258]
   complexed with cl, seo; mutant

Details for d1t6ha_

PDB Entry: 1t6h, 2.01 Å

PDB Description: crystal structure t4 lysozyme incorporating an unnatural amino acid p- iodo-l-phenylalanine at position 153

SCOP Domain Sequences for d1t6ha_:

Sequence; same for both SEQRES and ATOM records:

>d1t6ha_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

Timeline for d1t6ha_:

• d1t6ha_ is new in SCOP 1.71
  
• d1t6ha_ appears in SCOP 1.73
  
• d1t6ha_ appears in the current release, SCOPe 2.08