Lineage for d1t5ga_ (1t5g A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 583911Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 583912Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) (S)
  5. 583913Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins)
    Pfam 00491
  6. 583934Protein Arginase [52770] (3 species)
  7. 583973Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (21 PDB entries)
  8. 583989Domain d1t5ga_: 1t5g A: [112254]

Details for d1t5ga_

PDB Entry: 1t5g (more details), 2.4 Å

PDB Description: arginase-f2-l-arginine complex

SCOP Domain Sequences for d1t5ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5ga_ c.42.1.1 (A:) Arginase {Rat (Rattus norvegicus)}
kpieiigapfskgcprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlaviwvda
htdintplttssgnlagqpvafllkelkgkfpdvpgfswvtpaisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlsafg
tkregnhkpetdyl

SCOP Domain Coordinates for d1t5ga_:

Click to download the PDB-style file with coordinates for d1t5ga_.
(The format of our PDB-style files is described here.)

Timeline for d1t5ga_: