SCOP 1.73: Domain d1t4za_: 1t4z A:

Lineage for d1t4za_ (1t4z A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.15: KaiB-like [102449] (2 proteins)
   Pfam PF07689; contains members with alternative folds

6. Protein Adaptive-response sensory-kinase SasA, N-terminal domain [117596] (1 species)
   has a canonical thioredoxin fold

7. Species Synechococcus elongatus [TaxId:32046] [117597] (2 PDB entries)

8. Domain d1t4za_: 1t4z A: [112249]

Details for d1t4za_

PDB Entry: 1t4z

PDB Description: Solution structure of the N-terminal domain of Synechococcus elongatus SasA (25-structures ensemble)

PDB Compounds: (A:) Adaptive-response sensory-kinase sasA

SCOP Domain Sequences for d1t4za_:

Sequence; same for both SEQRES and ATOM records:

>d1t4za_ c.47.1.15 (A:) Adaptive-response sensory-kinase SasA, N-terminal domain {Synechococcus elongatus [TaxId: 32046]}
gsslspqalaqplllqlfvdtrplsqhivqrvknilaaveatvpislqvinvadqpqlve
yyrlvvtpalvkigpgsrqvlsgidltdqlanqlpqwlvqqegif

Timeline for d1t4za_:

• d1t4za_ first appeared in SCOP 1.71
  
• d1t4za_ appears in SCOP 1.75
  
• d1t4za_ appears in the current release, SCOPe 2.08, called d1t4za1