Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.15: KaiB-like [102449] (3 proteins) Pfam PF07689; contains members with alternative folds |
Protein Adaptive-response sensory-kinase SasA, N-terminal domain [117596] (1 species) has a canonical thioredoxin fold |
Species Synechococcus elongatus [TaxId:32046] [117597] (2 PDB entries) Uniprot Q06904 19-109 # 97% sequence identity |
Domain d1t4za1: 1t4z A:3-102 [112249] Other proteins in same PDB: d1t4za2, d1t4za3 |
PDB Entry: 1t4z (more details)
SCOPe Domain Sequences for d1t4za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t4za1 c.47.1.15 (A:3-102) Adaptive-response sensory-kinase SasA, N-terminal domain {Synechococcus elongatus [TaxId: 32046]} slspqalaqplllqlfvdtrplsqhivqrvknilaaveatvpislqvinvadqpqlveyy rlvvtpalvkigpgsrqvlsgidltdqlanqlpqwlvqqe
Timeline for d1t4za1: