Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins) |
Protein Interleukin-1beta [50363] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50364] (53 PDB entries) Uniprot P01584 117-269 |
Domain d1t4qa_: 1t4q A: [112244] |
PDB Entry: 1t4q (more details), 2.1 Å
SCOPe Domain Sequences for d1t4qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t4qa_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]} apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvwnkieinnklefesaqfpnw yistsqaenmpvflggtkggqditdftmqfvss
Timeline for d1t4qa_: