Lineage for d1t4ma_ (1t4m A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706658Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 706659Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 707241Family c.69.1.18: Bacterial lipase [53570] (3 proteins)
    lack the first two strands of the common fold
  6. 707264Protein Lipase A [64145] (1 species)
    minimal alpha/beta hydrolase fold;
  7. 707265Species Bacillus subtilis [TaxId:1423] [64146] (6 PDB entries)
  8. 707274Domain d1t4ma_: 1t4m A: [112243]
    complexed with k; mutant

Details for d1t4ma_

PDB Entry: 1t4m (more details), 2 Å

PDB Description: structure of a thermostable double mutant of bacillus subtilis lipase obtained through directed evolution
PDB Compounds: (A:) lipase a

SCOP Domain Sequences for d1t4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t4ma_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssddmivmnylsrldgarnvqihgvghigllyssqvyslikeglngggqntn

SCOP Domain Coordinates for d1t4ma_:

Click to download the PDB-style file with coordinates for d1t4ma_.
(The format of our PDB-style files is described here.)

Timeline for d1t4ma_: