Lineage for d1t4kd1 (1t4k D:1-113)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353475Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 2353522Domain d1t4kd1: 1t4k D:1-113 [112241]
    Other proteins in same PDB: d1t4ka1, d1t4ka2, d1t4kb2, d1t4kc1, d1t4kc2, d1t4kd2
    MQ P018119 P01868 # natural chimera; catalytic antibody with aldolase activity
    complexed with zn

Details for d1t4kd1

PDB Entry: 1t4k (more details), 2.5 Å

PDB Description: Crystal Structure of Unliganded Aldolase Antibody 93F3 Fab
PDB Compounds: (D:) immunoglobulin igg1, heavy chain

SCOPe Domain Sequences for d1t4kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t4kd1 b.1.1.1 (D:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
evmlvesgpglvapsqslsitctvsgfslsdygvswirqppgkglewlgviwgdgstyya
salkfrltiskdssksqvflnmhslqtddsamyycakhtyggpgdswgqgtsvtvss

SCOPe Domain Coordinates for d1t4kd1:

Click to download the PDB-style file with coordinates for d1t4kd1.
(The format of our PDB-style files is described here.)

Timeline for d1t4kd1: