SCOPe 2.02: Domain d1t4kc1: 1t4k C:1-107

Lineage for d1t4kc1 (1t4k C:1-107)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (36 PDB entries)

8. Domain d1t4kc1: 1t4k C:1-107 [112239]
   Other proteins in same PDB: d1t4ka2, d1t4kb1, d1t4kb2, d1t4kc2, d1t4kd1, d1t4kd2
   MQ P01632 P01837 # natural chimera; catalytic antibody with aldolase activity
   complexed with zn

Details for d1t4kc1

PDB Entry: 1t4k, 2.5 Å

PDB Description: Crystal Structure of Unliganded Aldolase Antibody 93F3 Fab

PDB Compounds: (C:) immunoglobulin igg1, kappa light chain

SCOPe Domain Sequences for d1t4kc1:

Sequence; same for both SEQRES and ATOM records:

>d1t4kc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
diqmtqspsslavspgekvtmscrssqslfnsrtrknylawyqqkpgqsptkliywastr
esgvpdrftgsgsgtdftltissvqaedlaiyyckqsydlptfgagtklelk

Timeline for d1t4kc1:

• d1t4kc1 first appeared in SCOP 1.71
  
• d1t4kc1 appears in SCOPe 2.01
  
• d1t4kc1 appears in SCOPe 2.03
  
• d1t4kc1 appears in the current release, SCOPe 2.08