Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families) |
Family c.55.5.1: MTH1175-like [53147] (3 proteins) |
Protein Hypothetical protein TM1816 [82446] (1 species) |
Species Thermotoga maritima [TaxId:2336] [82447] (2 PDB entries) Uniprot Q9X2D6 1-115 |
Domain d1t3va_: 1t3v A: [112232] Structural genomics target |
PDB Entry: 1t3v (more details)
SCOPe Domain Sequences for d1t3va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3va_ c.55.5.1 (A:) Hypothetical protein TM1816 {Thermotoga maritima [TaxId: 2336]} miiaipvsenrgkdspisehfgrapyfafvkvknnaiadisveenplaqdhvhgavpnfv kekgaelvivrgigrraiaafeamgvkvikgasgtveevvnqylsgqlkdsdyevhdhhh hehh
Timeline for d1t3va_: