Lineage for d1t3va_ (1t3v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2887722Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families) (S)
  5. 2887723Family c.55.5.1: MTH1175-like [53147] (3 proteins)
  6. 2887730Protein Hypothetical protein TM1816 [82446] (1 species)
  7. 2887731Species Thermotoga maritima [TaxId:2336] [82447] (2 PDB entries)
    Uniprot Q9X2D6 1-115
  8. 2887733Domain d1t3va_: 1t3v A: [112232]
    Structural genomics target

Details for d1t3va_

PDB Entry: 1t3v (more details)

PDB Description: the nmr solution structure of tm1816
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1t3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3va_ c.55.5.1 (A:) Hypothetical protein TM1816 {Thermotoga maritima [TaxId: 2336]}
miiaipvsenrgkdspisehfgrapyfafvkvknnaiadisveenplaqdhvhgavpnfv
kekgaelvivrgigrraiaafeamgvkvikgasgtveevvnqylsgqlkdsdyevhdhhh
hehh

SCOPe Domain Coordinates for d1t3va_:

Click to download the PDB-style file with coordinates for d1t3va_.
(The format of our PDB-style files is described here.)

Timeline for d1t3va_: