SCOPe 2.06: Domain d1t3fb1: 1t3f B:1-118

Lineage for d1t3fb1 (1t3f B:1-118)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (68 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d1t3fb1: 1t3f B:1-118 [112230]
   Other proteins in same PDB: d1t3fa1, d1t3fa2, d1t3fb2

Details for d1t3fb1

PDB Entry: 1t3f, 2 Å

PDB Description: three dimensional structure of a humanized anti-ifn-gamma fab (huzaf) in p21 21 21 space group

PDB Compounds: (B:) Huzaf Antibody Heavy Chain

SCOPe Domain Sequences for d1t3fb1:

Sequence; same for both SEQRES and ATOM records:

>d1t3fb1 b.1.1.1 (B:1-118) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvqsgaelkkpgssvkvsckasgyiftsswinwvkqapgqglewigridpsdgevhy
nqdfkdkatltvdkstntaymelsslrsedtavyycargflpwfadwgqgtlvtvssa

Timeline for d1t3fb1:

• d1t3fb1 first appeared in SCOP 1.71
  
• d1t3fb1 appears in SCOPe 2.05
  
• d1t3fb1 appears in SCOPe 2.07
  
• d1t3fb1 appears in the current release, SCOPe 2.08