Lineage for d1t3fa2 (1t3f A:109-214)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028190Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2028191Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2028202Domain d1t3fa2: 1t3f A:109-214 [112229]
    Other proteins in same PDB: d1t3fa1, d1t3fb1, d1t3fb2

Details for d1t3fa2

PDB Entry: 1t3f (more details), 2 Å

PDB Description: three dimensional structure of a humanized anti-ifn-gamma fab (huzaf) in p21 21 21 space group
PDB Compounds: (A:) Huzaf Antibody Light Chain

SCOPe Domain Sequences for d1t3fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3fa2 b.1.1.2 (A:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d1t3fa2:

Click to download the PDB-style file with coordinates for d1t3fa2.
(The format of our PDB-style files is described here.)

Timeline for d1t3fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t3fa1