SCOPe 2.08: Domain d1t3fa2: 1t3f A:109-214

Lineage for d1t3fa2 (1t3f A:109-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1t3fa2: 1t3f A:109-214 [112229]
   Other proteins in same PDB: d1t3fa1, d1t3fb1, d1t3fb2

Details for d1t3fa2

PDB Entry: 1t3f, 2 Å

PDB Description: three dimensional structure of a humanized anti-ifn-gamma fab (huzaf) in p21 21 21 space group

PDB Compounds: (A:) Huzaf Antibody Light Chain

SCOPe Domain Sequences for d1t3fa2:

Sequence; same for both SEQRES and ATOM records:

>d1t3fa2 b.1.1.2 (A:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d1t3fa2:

• d1t3fa2 first appeared in SCOP 1.71
  
• d1t3fa2 appears in SCOPe 2.07