Lineage for d1t3fa1 (1t3f A:1-108)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353666Species Engineered (including hybrid species) [88533] (63 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 2353669Domain d1t3fa1: 1t3f A:1-108 [112228]
    Other proteins in same PDB: d1t3fa2, d1t3fb1, d1t3fb2

Details for d1t3fa1

PDB Entry: 1t3f (more details), 2 Å

PDB Description: three dimensional structure of a humanized anti-ifn-gamma fab (huzaf) in p21 21 21 space group
PDB Compounds: (A:) Huzaf Antibody Light Chain

SCOPe Domain Sequences for d1t3fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3fa1 b.1.1.1 (A:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspstlsasvgdrvtitckasenvdtyvswyqqkpgkapklliygasnrytgvps
rfsgsgsgtdftltisslqpddfatyycgqsynypftfgqgtkvevkr

SCOPe Domain Coordinates for d1t3fa1:

Click to download the PDB-style file with coordinates for d1t3fa1.
(The format of our PDB-style files is described here.)

Timeline for d1t3fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t3fa2