SCOPe 2.07: Domain d1t2lb_: 1t2l B:

Lineage for d1t2lb_ (1t2l B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.2: Cofilin-like [55762] (8 proteins)

6. Protein Coactosin-like protein Cotl1 (Clp) [111105] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111107] (2 PDB entries)
   Uniprot Q14019

8. Domain d1t2lb_: 1t2l B: [112225]

Details for d1t2lb_

PDB Entry: 1t2l, 2.8 Å

PDB Description: Three Crystal Structures of Human Coactosin-like Protein

PDB Compounds: (B:) Coactosin-like protein

SCOPe Domain Sequences for d1t2lb_:

Sequence; same for both SEQRES and ATOM records:

>d1t2lb_ d.109.1.2 (B:) Coactosin-like protein Cotl1 (Clp) {Human (Homo sapiens) [TaxId: 9606]}
atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf
vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele
edfikselkk

Timeline for d1t2lb_:

• d1t2lb_ first appeared in SCOP 1.71
  
• d1t2lb_ appears in SCOPe 2.06
  
• d1t2lb_ appears in the current release, SCOPe 2.08