| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
| Protein Coactosin-like protein Cotl1 (Clp) [111105] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [111107] (2 PDB entries) Uniprot Q14019 |
| Domain d1t2la_: 1t2l A: [112224] |
PDB Entry: 1t2l (more details), 2.8 Å
SCOPe Domain Sequences for d1t2la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2la_ d.109.1.2 (A:) Coactosin-like protein Cotl1 (Clp) {Human (Homo sapiens) [TaxId: 9606]}
atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf
vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele
edfikselkkaggany
Timeline for d1t2la_: