Lineage for d1t2kd_ (1t2k D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644061Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 2644062Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 2644127Protein Cyclic-AMP-dependent transcription factor ATF-2 [118363] (1 species)
  7. 2644128Species Human (Homo sapiens) [TaxId:9606] [118364] (1 PDB entry)
    Uniprot P15336 336-396
  8. 2644129Domain d1t2kd_: 1t2k D: [112223]
    Other proteins in same PDB: d1t2ka_, d1t2kb_, d1t2kc1, d1t2kc2
    protein/DNA complex

Details for d1t2kd_

PDB Entry: 1t2k (more details), 3 Å

PDB Description: structure of the dna binding domains of irf3, atf-2 and jun bound to dna
PDB Compounds: (D:) Cyclic-AMP-dependent transcription factor ATF-2

SCOPe Domain Sequences for d1t2kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2kd_ h.1.3.1 (D:) Cyclic-AMP-dependent transcription factor ATF-2 {Human (Homo sapiens) [TaxId: 9606]}
krrkflernraaasrsrqkrkvwvqslekkaedlsslngqlqsevtllrnevaqlkqlll
a

SCOPe Domain Coordinates for d1t2kd_:

Click to download the PDB-style file with coordinates for d1t2kd_.
(The format of our PDB-style files is described here.)

Timeline for d1t2kd_: