![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.3: Leucine zipper domain [57959] (1 family) ![]() |
![]() | Family h.1.3.1: Leucine zipper domain [57960] (16 proteins) |
![]() | Protein Cyclic-AMP-dependent transcription factor ATF-2 [118363] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118364] (1 PDB entry) Uniprot P15336 336-396 |
![]() | Domain d1t2kd_: 1t2k D: [112223] Other proteins in same PDB: d1t2ka_, d1t2kb_, d1t2kc_ mutant |
PDB Entry: 1t2k (more details), 3 Å
SCOP Domain Sequences for d1t2kd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2kd_ h.1.3.1 (D:) Cyclic-AMP-dependent transcription factor ATF-2 {Human (Homo sapiens) [TaxId: 9606]} krrkflernraaasrsrqkrkvwvqslekkaedlsslngqlqsevtllrnevaqlkqlll a
Timeline for d1t2kd_: