SCOP 1.73: Domain d1t2kd_: 1t2k D:

Lineage for d1t2kd_ (1t2k D:)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family)

5. Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)

6. Protein Cyclic-AMP-dependent transcription factor ATF-2 [118363] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118364] (1 PDB entry)

8. Domain d1t2kd_: 1t2k D: [112223]
   Other proteins in same PDB: d1t2ka_, d1t2kb_, d1t2kc_
   mutant

Details for d1t2kd_

PDB Entry: 1t2k, 3 Å

PDB Description: structure of the dna binding domains of irf3, atf-2 and jun bound to dna

PDB Compounds: (D:) Cyclic-AMP-dependent transcription factor ATF-2

SCOP Domain Sequences for d1t2kd_:

Sequence; same for both SEQRES and ATOM records:

>d1t2kd_ h.1.3.1 (D:) Cyclic-AMP-dependent transcription factor ATF-2 {Human (Homo sapiens) [TaxId: 9606]}
krrkflernraaasrsrqkrkvwvqslekkaedlsslngqlqsevtllrnevaqlkqlll
a

Timeline for d1t2kd_:

• d1t2kd_ first appeared in SCOP 1.71
  
• d1t2kd_ appears in SCOP 1.75
  
• d1t2kd_ appears in the current release, SCOPe 2.08