Lineage for d1t2kd_ (1t2k D:)

  1. Root: SCOP 1.71
  2. 625746Class h: Coiled coil proteins [57942] (7 folds)
  3. 625747Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 625902Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 625903Family h.1.3.1: Leucine zipper domain [57960] (15 proteins)
  6. 625958Protein Cyclic-AMP-dependent transcription factor ATF-2 [118363] (1 species)
  7. 625959Species Human (Homo sapiens) [TaxId:9606] [118364] (1 PDB entry)
  8. 625960Domain d1t2kd_: 1t2k D: [112223]
    Other proteins in same PDB: d1t2ka_, d1t2kb_, d1t2kc_
    mutant

Details for d1t2kd_

PDB Entry: 1t2k (more details), 3 Å

PDB Description: structure of the dna binding domains of irf3, atf-2 and jun bound to dna

SCOP Domain Sequences for d1t2kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2kd_ h.1.3.1 (D:) Cyclic-AMP-dependent transcription factor ATF-2 {Human (Homo sapiens)}
krrkflernraaasrsrqkrkvwvqslekkaedlsslngqlqsevtllrnevaqlkqlll
a

SCOP Domain Coordinates for d1t2kd_:

Click to download the PDB-style file with coordinates for d1t2kd_.
(The format of our PDB-style files is described here.)

Timeline for d1t2kd_: