Lineage for d1t2kb_ (1t2k B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533553Family a.4.5.23: Interferon regulatory factor [46877] (3 proteins)
    Pfam 00605
  6. 533558Protein Interferon regulatory factor 3, IRF-3 [116791] (1 species)
  7. 533559Species Human (Homo sapiens) [TaxId:9606] [116792] (1 PDB entry)
  8. 533561Domain d1t2kb_: 1t2k B: [112221]
    Other proteins in same PDB: d1t2kc_, d1t2kd_
    mutant

Details for d1t2kb_

PDB Entry: 1t2k (more details), 3 Å

PDB Description: Structure Of The DNA Binding Domains Of IRF3, ATF-2 and Jun Bound To DNA

SCOP Domain Sequences for d1t2kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2kb_ a.4.5.23 (B:) Interferon regulatory factor 3, IRF-3 {Human (Homo sapiens)}
pkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatga
yvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvn

SCOP Domain Coordinates for d1t2kb_:

Click to download the PDB-style file with coordinates for d1t2kb_.
(The format of our PDB-style files is described here.)

Timeline for d1t2kb_: