SCOP 1.73: Domain d1t2ka_: 1t2k A:

Lineage for d1t2ka_ (1t2k A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.23: Interferon regulatory factor [46877] (3 proteins)
   Pfam PF00605

6. Protein Interferon regulatory factor 3, IRF-3 [116791] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116792] (1 PDB entry)

8. Domain d1t2ka_: 1t2k A: [112220]
   Other proteins in same PDB: d1t2kc_, d1t2kd_

Details for d1t2ka_

PDB Entry: 1t2k, 3 Å

PDB Description: structure of the dna binding domains of irf3, atf-2 and jun bound to dna

PDB Compounds: (A:) Interferon regulatory factor 3

SCOP Domain Sequences for d1t2ka_:

Sequence; same for both SEQRES and ATOM records:

>d1t2ka_ a.4.5.23 (A:) Interferon regulatory factor 3, IRF-3 {Human (Homo sapiens) [TaxId: 9606]}
tpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatg
ayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvns

Timeline for d1t2ka_:

• d1t2ka_ first appeared in SCOP 1.71
  
• d1t2ka_ appears in SCOP 1.75
  
• d1t2ka_ appears in the current release, SCOPe 2.08